Home Made Cronut (Croissoughnuts)

 6 orang   Waktu: 7 jam
W1siziisijiwmtqvmdyvmdcvmtyvndcvmjivndy0lzezzmm2os5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcizmjb4il1d?sha=800fb232
Simpan
resep ini
Mau menyimpan resep ini? Cookmark sekarang!

Terinspirasi dari resep ini?

Ask to create recipe
W1siziisijiwmtqvmdyvmdcvmtuvmtkvmjivnzexlzmyzgzlms5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilciymdb4mjawiyjdxq?sha=ef153562
dari Dapurnya

Cerita di balik resep ini

Apa itu Cronut? hmm...Dish yg satu ini lagi happening banget di New York City. Ditemukan oleh Chef Dominique Ansel yg mengkolaborasi bahan & akhirnya menemukan "Cronut". Cronut ialah kombinasi dari Half Croissant & Half Donuts. Hasilnya Tinggi & terlihat lipatan dough, membuatnya butuh extra kesabaran. dari resep yg saya dapat, saya coba 1/2 bahan & meskipun hasilnya belum maksimal, I'll try again

Bahan-bahan

Susu Cair Sapi187 ml
Active Dried yeast1 sendok makan
Gula Kastor75 gram
Telur Ayam2 butir
Vanili1 sendok teh
Tepung Terigu Protein Sedang3 1/2 cangkir
Garam1 sendok teh
Unsalted Butter227 gram
Gula Icing1/2 cangkir
Madu3 sendok makan
Susu Cair Sapi1 1/2 sendok makan
Gula Donat200 gram

Cara membuat

1
W1siziisijiwmtqvmdyvmdcvmtcvndivmzgvndmzlzlkymflzs5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=dab7e468
- siapkan semua bahan - hangatkan susu cair

2
W1siziisijiwmtqvmdyvmdcvmtcvndivmzkvnde3lzhmywy4nc5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=185a81a9
campur jadi satu : susu cair hangat, yeast, telur, gula dan vanila. aduk rata dan diamkan kurang lebih 10 menit.

3
W1siziisijiwmtqvmdyvmdcvmtcvndivndavmjm0lzy0zjuyni5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=9495342e
dalam wadah terpisah. campur terigu, garam dan butter. aduk menggunakan pisau pastry (psatry blender) , bisa juga pakai garpu. hingga adonan kering menjadi crumble.

4
W1siziisijiwmtqvmdyvmdcvmtcvndivndevmje3l2jinti0oc5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=323a11fc
masukkan adonan cair ke adonan kering. aduk-aduk hingga rata dan kalis

5
W1siziisijiwmtqvmdyvmdcvmtcvndivndivodg0lzi5zjayyy5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=2dbc6d77
Setelah kalis, bungkus dengan plastik wrap dan simpan dalam kulkas selama 30 menit.

6
W1siziisijiwmtqvmdyvmdcvmtcvndivndmvmjm0lzm2zwzkmi5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=e2903a22
keluarkan adonan dari kulkas. taru adonan pada permukaan bertepung lalu giling membentuk persegi panjang dgn tebal kurleb 0.5 cm. lalu lalu lipat 1/3 bagian kiri menutup 1/3 bagian tengah dan juga 1/3 bagian kanan (seperti menutup buku). lalu simpan dalam kulkas selama 30 menit.

7
W1siziisijiwmtqvmdyvmdcvmtcvndivndqvntgylzy4mzqwnc5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=e9e6b227
setelah 30 menit, keluarkan dari kulkas, giling lagi, lalu lipat lagi seperti buku yang dilipat kiri kanan) masukkan lagi dalam kulkas. lakukan hal ini hingga 4 kali. total menggiling, melipat dan mengistirahatkan sekitar 2.5 - 3 jam

8
W1siziisijiwmtqvmdyvmdcvmtcvndivnduvmjywl2u2nza0ny5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=f5318f88
Setelah mengistirahakan adonan pada lipatan ke-4. giling lagi adonan, gunakan cetakan donut

9
W1siziisijiwmtqvmdyvmdcvmtcvndivndyvode3lzjjztgzzi5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=d47f24e8
setelah dicetak, istirahatkan lagi adonan hingga mengembang (kurleb 20 menit). sembari menunggu mengembang. siapkan "Glazed madu" yaitu dengan mencampur : gula bubuk, susu cair dan madu. aduk-aduk hingga rata. (hasil nya seperti royal icing).

10
W1siziisijiwmtqvmdyvmdcvmtcvndivndcvnjqwl2u0mzkzyy5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50il0swyjwiiwidgh1bwiilcixodb4il1d?sha=190f0951
Goreng Cronut hingga matang. angkat dan tiriskan. selagi hangat beri taburan gula donut. lalu beri madu glzed. setelah matang, Cronuts bisa di isi dengan kocokan cream, custard cream (pastry cream), bisa ditabur gula cinnamon, bisa diberi topping sugar glazed, maple glazed, honey glazed, kacang dan macam-macam. adonan nya pun bisa diberi rasa macam-macam seperti keju, kismis, lemon dll.

Lyra jufa
BalasLyRa JuFa mba,ukuran cup bwt terigu kalo dijadiin ukuran gram jd brp yah? trus tu gula icingnya bwt apa mba? maaf bnyk nanya... :D
Indirouche
BalasIndirouche yeast itu apa ya ?
Hes hidayat
BalasHes Hidayat Waaah keduluaan. Baru mau bikin :D hehe. Nanti recook aahh. Trims mba
CTA
CTA_event

Kategori resepLihat semua >

Lihat semua kategori